Rabbit Polyclonal Anti-UVRAG Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | UVRAG antibody was raised against an 18 amino acid peptide near the carboxy terminus of human UVRAG. |
Rabbit Polyclonal Anti-UVRAG Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | UVRAG antibody was raised against an 18 amino acid peptide near the carboxy terminus of human UVRAG. |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
Rabbit polyclonal CDC2 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CDC2. |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: CAICTLFYPYCQALQTEKEAPIASLGEGCPATLPSKSRQKTRPLIPEMCF |
Rabbit Polyclonal Anti-CDC2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP |
Rabbit Polyclonal Anti-CDC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 Antibody: A synthesized peptide derived from human CDC2 |
Rabbit Polyclonal CDC2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC2 |
Rabbit Polyclonal CDC2 (Tyr15) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CDC2 around the phosphorylation site of Tyrosine 15 |
Modifications | Phospho-specific |
Rabbit polyclonal CDC2 (Ab-161) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC2 around the phosphorylation site of Threonine161. |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the C terminal of human CDC2. Synthetic peptide located within the following region: SLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
Rabbit Polyclonal Antibody against CDC2 (T14)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from human CDK1. |
Rabbit Polyclonal Antibody against CDC2 (N-term)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human CDC2. |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the N terminal of human CDC2. Synthetic peptide located within the following region: EDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIRE |
Rabbit Polyclonal Anti-TUBA3C Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: VDLEPTVVDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDL |
Rabbit anti CDC2 (pY15) (CDK1) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- with a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit anti CDC2 (Paired Y15) (CDK1) Polyclonal Antibody
Applications | Dot, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide surrounding to the epitope -GTYGV- without a phosphorylation site at Tyr15 of human CDC2 protein. This sequence is identical among human, mouse, rat, bovine and chicken species. |
Rabbit anti CDC2 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Bovine, Chicken, Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the C-terminus of CDC2 protein from human, rat and mouse origins |
CDK1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CDK1 pTyr15 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Antibody against CDC2 (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDC2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 213-241 amino acids from the C-terminal region of human CDC2. |
Rabbit Polyclonal Alpha-tubulin Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Rabbit polyclonal Tubulin antibody was raised against a 16 amino acid peptide near the amino terminus of human Tubulin. |
Rabbit Polyclonal Anti-CDK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC2 antibody: synthetic peptide directed towards the middle region of human CDC2. Synthetic peptide located within the following region: KLADFGLARAFGIPIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGT |
Phospho-CDK1-Y15 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y15 of human CDK1 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-TUBA3C Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for Anti-TUBA3C Antibody: synthetic peptide directed towards the N terminal of human TUBA3C. Synthetic peptide located within the following region: QMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVVDEVRTGTYR |
Anti-CDK1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 219-233 amino acids of Human Cyclin-dependent kinase 1 |