Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-COPS3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-COPS3 Antibody: A synthesized peptide derived from human COPS3

Rabbit polyclonal anti-JAB1 / COPS3 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human JAB1.

Goat Anti-COPS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SLYKKNIQRLT, from the internal region of the protein sequence according to NP_003644.2.

Rabbit Polyclonal Anti-COPS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COPS3 antibody is: synthetic peptide directed towards the C-terminal region of Human COPS3. Synthetic peptide located within the following region: HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS

Rabbit Polyclonal Anti-COPS3 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Cops3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cops3. Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD