Primary Antibodies

View as table Download

Rabbit Polyclonal HOXD10 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

HOXD10 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Zebrafish
Immunogen KLH conjugated synthetic peptide between 305-334 amino acids from the C-terminal region of Human HOXD10

Goat Anti-HOXD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PNRSCRIEQPVTQQ, from the internal region of the protein sequence according to NP_002139.2.

Rabbit Polyclonal Anti-HOXD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXD10 antibody: synthetic peptide directed towards the middle region of human HOXD10. Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA