Primary Antibodies

View as table Download

Rabbit polyclonal FBXW11 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FBXW11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-196 amino acids from the Central region of human FBXW11.

Rabbit polyclonal Beta TrCP2 antibody

Applications WB
Reactivities Bovine, Chicken, Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminal of human βTrCP2 protein.

Rabbit Polyclonal Anti-FBXW11 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXW11 antibody: synthetic peptide directed towards the N terminal of human FBXW11. Synthetic peptide located within the following region: CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESD

Rabbit Polyclonal Anti-FBXW11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FBXW11 antibody: synthetic peptide directed towards the N terminal of human FBXW11. Synthetic peptide located within the following region: EPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRP

FBXW11 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human FBXW11 (NP_387448.2).
Modifications Unmodified