Primary Antibodies

Jump to Filters
View as table Download
Kindlin 2 (FERMT2) Rabbit Polyclonal Antibody
TA332020

USD 375.00

5 Days

Rabbit Polyclonal Anti-FERMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FERMT2 Antibody is: synthetic peptide directed towards the C-terminal region of Human FERMT2. Synthetic peptide located within the following region: TSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGM
Kindlin 2 (FERMT2) Rabbit Polyclonal Antibody
TA376205

USD 220.00

3 Weeks

FERMT2 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 380-550 of human FERMT2 (NP_006823.1).
Modifications Unmodified