Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-HMGCS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the C terminal of human HMGCS2. Synthetic peptide located within the following region: DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE |
Rabbit Polyclonal Anti-HMGCS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the N terminal of human HMGCS2. Synthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE |
Rabbit Polyclonal Anti-HMGCS2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HMGCS2 |
HMGCS2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 269-508 of human HMGCS2 (NP_005509.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- HMGCS2
Isotypes
- IgG
Clonalities
- Polyclonal