HMGCS2 Rabbit Polyclonal Antibody

CAT#: TA346114

Rabbit Polyclonal Anti-HMGCS2 Antibody

Product Images

WB Suggested Anti-HMGCS2 Antibody Titration: 1.25 ug/ml; Positive Control: Human Liver

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HMGCS2 antibody: synthetic peptide directed towards the C terminal of human HMGCS2. Synthetic peptide located within the following region: DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: 3-hydroxy-3-methylglutaryl-CoA synthase 2
• Database Link:
  NP_005509
  Entrez Gene 3158 Human
  UniProt ID P54868
• Background: This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
• Synonyms: 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial); hydroxymethylglutaryl-CoA synthase 2; OTTHUMP00000013928
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Pig: 86%; Guinea pig: 86%; Goat: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Metabolic pathways, PPAR signaling pathway, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Valine, leucine and isoleucine degradation