Primary Antibodies

View as table Download

Rabbit polyclonal Anti-SH3BP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3BP2 antibody: synthetic peptide directed towards the middle region of human SH3BP2. Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

SH3BP2 sheep polyclonal antibody, Purified

Applications WB
Reactivities Mouse
Immunogen Antibody developed using SH2 domain of the 3BP2 protein fused to GST.

SH3BP2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 392-561 of human SH3BP2 (NP_001116153.1).
Modifications Unmodified