Primary Antibodies

View as table Download

USP2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human
Immunogen USP2 antibody was raised against synthetic 19 amino acid peptide from internal region of human USP2. Percent identity with other species by BLAST analysis: Human (100%); Monkey, Marmoset (95%); Gibbon (89%); Rabbit, Opossum (84%).

USP2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human, Monkey
Immunogen USP2 antibody was raised against synthetic 18 amino acid peptide from internal region of human USP2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Dog, Panda, Horse, Rabbit, Pig (94%); Marmoset, Mouse, Rat, Bovine, Hamster, Elephant (89%); Opossum (83%).

USP2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen USP2 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human USP2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Horse, Rabbit, Opossum (100%); Pig (94%).

Rabbit Polyclonal Anti-USP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP2 antibody: synthetic peptide directed towards the middle region of human USP2. Synthetic peptide located within the following region: NEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK

Rabbit Polyclonal Anti-USP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USP2 antibody: synthetic peptide directed towards the N terminal of human USP2. Synthetic peptide located within the following region: LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN

Rabbit Polyclonal Anti-USP2 Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human USP2

USP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human USP2