USP2 Rabbit Polyclonal Antibody

CAT#: TA342570

Rabbit Polyclonal Anti-USP2 Antibody

Product Images

WB Suggested Anti-USP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HCT15 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-USP2 antibody: synthetic peptide directed towards the N terminal of human USP2. Synthetic peptide located within the following region: LLDYDRGRPLLRPDITGGGKRAESQTRGTERPLGSGLSGGSGFPYGVTNN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: ubiquitin specific peptidase 2
• Database Link:
  NP_004196
  Entrez Gene 9099 Human
  UniProt ID O75604
• Background: Ubiquitin (MIM 191339), a highly conserved protein involved in the regulation of intracellular protein breakdown, cell cycle regulation, and stress response, is released from degraded proteins by disassembly of the polyubiquitin chains. The disassembly process is mediated by ubiquitin-specific proteases (USPs). Also see USP1 (MIM 603478).
• Synonyms: UBP41; USP9
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Horse: 86%; Mouse: 83%

Reference Data

• Protein Families: Protease