Rabbit anti-GLUL Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GLUL |
Rabbit anti-GLUL Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GLUL |
Glutamine Synthetase (GLUL) rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-GLUL Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.365~369(G-D-E-P-F) derived from Human Glutamine Synthetase |
Glutamine Synthetase (GLUL) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human GLUL |
Rabbit Polyclonal Antibody against Glutamine Synthase
Applications | WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein. |
Rabbit Polyclonal Anti-GLUL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLUL antibody: synthetic peptide directed towards the C terminal of human GLUL. Synthetic peptide located within the following region: TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS |
Rabbit Polyclonal Anti-GLUL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GLUL |