Rabbit anti-PSMA4 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA4 |
Rabbit anti-PSMA4 Polyclonal Antibody
Applications | ICC/IF, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA4 |
PSMA4 goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_002780.1 and NP_001096138.1 |
Rabbit Polyclonal Anti-PSMA4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PSMA4 Antibody: synthetic peptide directed towards the N terminal of human PSMA4. Synthetic peptide located within the following region: PCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGN |