RPS18 (Center) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 62-91 amino acids from the Central region of Human RS18. |
RPS18 (Center) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 62-91 amino acids from the Central region of Human RS18. |
Rabbit polyclonal anti-RPS18 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RPS18. |
Rabbit Polyclonal Anti-RPS18 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RPS18 antibody is: synthetic peptide directed towards the C-terminal region of Human RPS18. Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK |