RPS18 Rabbit Polyclonal Antibody

CAT#: TA330910

Rabbit Polyclonal Anti-RPS18 Antibody

Product Images

Host: Rabbit; Target Name: RPS18; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RPS18 antibody is: synthetic peptide directed towards the C-terminal region of Human RPS18. Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 17 kDa
• Gene Name: ribosomal protein S18
• Database Link:
  NP_072045
  Entrez Gene 6222 Human
  UniProt ID P62269
• Background: RPS18 located at the top of the head of the 40S subunit, it contacts several helices of the 18S rRNA.
• Synonyms: D6S218E; HKE3; KE-3; KE3; S18
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Ribosome