Antibodies

Jump to Filters
View as table Download
RPS18 (Center) Rabbit Polyclonal Antibody
AP17722PU-N

USD 450.00

In Stock

RPS18 (Center) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 62-91 amino acids from the Central region of Human RS18.
RPS18 Rabbit Polyclonal Antibody
TA314493

USD 345.00

In Stock

Rabbit polyclonal anti-RPS18 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RPS18.
RPS18 Rabbit Polyclonal Antibody
TA330910

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPS18 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RPS18 antibody is: synthetic peptide directed towards the C-terminal region of Human RPS18. Synthetic peptide located within the following region: NGLDNKLREDLERLKKIRAHRGLRHFWGLRVRGQHTKTTGRRGRTVGVSK
RPS18 Rabbit Polyclonal Antibody
TA381099

USD 220.00

3 Weeks

RPS18 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human RPS18 (NP_072045.1).
Modifications Unmodified