Primary Antibodies

View as table Download

Rabbit polyclonal CYP2S1 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CYP2S1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 399-428 amino acids from the C-terminal region of human CYP2S1.

Rabbit polyclonal Cytochrome P450 2S1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2S1.

Rabbit Polyclonal Anti-CYP2S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CYP2S1 Antibody: synthetic peptide directed towards the C terminal of human CYP2S1. Synthetic peptide located within the following region: MKYPHVQKWVREELNRELGAGQAPSLGDRTRLPYTDAVLHEAQRLLALVP

CYP2S1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human CP2S1