CYP2S1 Rabbit Polyclonal Antibody

CAT#: TA331713

Rabbit Polyclonal Anti-CYP2S1 Antibody

Product Images

WB Suggested Anti-CYP2S1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: ACHN cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CYP2S1 Antibody: synthetic peptide directed towards the C terminal of human CYP2S1. Synthetic peptide located within the following region: MKYPHVQKWVREELNRELGAGQAPSLGDRTRLPYTDAVLHEAQRLLALVP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 56 kDa
• Gene Name: cytochrome P450 family 2 subfamily S member 1
• Database Link:
  NP_085125
  Entrez Gene 29785 Human
  UniProt ID Q96SQ9
• Background: CYP2S1 has a potential importance for extrahepatic xenobiotic metabolism.
• Synonyms: CYPIIS1
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 90%; Goat: 83%; Sheep: 83%; Horse: 82%; Guinea pig: 82%

Reference Data

• Protein Families: Druggable Genome, P450, Transmembrane
• Protein Pathways: Metabolism of xenobiotics by cytochrome P450