ENPP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ENPP2 |
ENPP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ENPP2 |
Goat Polyclonal Anti-ENPP2 / AUTOTAXIN (aa698-712) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | internal region of NP_006200.3; NP_001035181.1, NP_001124335.1 (PDHLTSCVRPDVRVS) |
Rabbit Polyclonal Anti-ENPP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENPP2 Antibody: synthetic peptide directed towards the N terminal of human ENPP2. Synthetic peptide located within the following region: YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA |
ENPP2 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ENPP2 |
ENPP2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 564-863 of human ENPP2 (NP_001035181.1). |
Modifications | Unmodified |
ENPP2 Rabbit polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the Internal region of human ENPP2. AA range:401-450 |