ENPP2 Rabbit Polyclonal Antibody

CAT#: TA335975

Rabbit Polyclonal Anti-ENPP2 Antibody

Product Images

WB Suggested Anti-ENPP2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: COLO205 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ENPP2 Antibody: synthetic peptide directed towards the N terminal of human ENPP2. Synthetic peptide located within the following region: YTLATGLYPESHGIVGNSMYDPVFDATFHLRGREKFNHRWWGGQPLWITA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 95 kDa
• Gene Name: ectonucleotide pyrophosphatase/phosphodiesterase 2
• Database Link:
  NP_001035181
  Entrez Gene 5168 Human
  UniProt ID Q13822
• Background: The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: ATX; ATX-X; AUTOTAXIN; LysoPLD; NPP2; PD-IALPHA; PDNP2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Guinea pig: 100%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors, Transmembrane
• Protein Pathways: Ether lipid metabolism