Primary Antibodies

View as table Download

MTA2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MTA2

Rabbit Polyclonal MTA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTA2 antibody: human MTA2 (Human Metastasis associated 1 family, member 2), using a recombinant protein.

Rabbit polyclonal PID/MTA2 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This PID/MTA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 516-544 amino acids from the C-terminal region of human PID/MTA2.

Rabbit Polyclonal PID Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PID antibody was raised against a synthetic peptide corresponding to amino acids 652 to 668 of human PID (6), which differ from the mouse sequence by one amino acid (7) .

Rabbit Polyclonal Anti-MTA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTA2 antibody: synthetic peptide directed towards the N terminal of human MTA2. Synthetic peptide located within the following region: NGNVEAKVVCLFRRRDISSSLNSLADSNAREFEEESKQPGVSEQQRHQLK

Rabbit Polyclonal Anti-MTA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTA2 antibody: synthetic peptide directed towards the middle region of human MTA2. Synthetic peptide located within the following region: WKKYGGLKTPTQLEGATRGTTEPHSRGHLSRPEAQSLSPYTTSANRAKLL

Rabbit Polyclonal Anti-MTA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MTA2 antibody: synthetic peptide directed towards the C terminal of human MTA2. Synthetic peptide located within the following region: DAPNPVVFVATKDTRALRKALTHLEMRRAARRPNLPLKVKPTLIAVRPPV

Rabbit anti PKC (pS345) Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope -EDR-S-KSAP- with a phosphorylated Ser 345 of human PKC.

Rabbit anti PID/MTA2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human p38 protein

UBE2L3 Antibody - C-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human UBE2L3

MTA2 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTA2

MTA2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MTA2

MTA2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human MTA2
Modifications Unmodified

MTA2 Rabbit polyclonal Antibody

Applications ChIP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-180 of human MTA2 (NP_004730.2).
Modifications Unmodified