Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications 10k-ChIP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: LEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWK

Goat Anti-PRMT3 (aa468-421) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence DPKTLISEPCGIKH, from the internal region of the protein sequence according to NP_005779.1; NP_001138638.1; NP_001138639.1.

Rabbit Polyclonal Anti-PRMT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS

Anti-PRMT3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 9-23 amino acids of Human protein arginine methyltransferase 3

PRMT3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human PRMT3 (NP_005779.1).
Modifications Unmodified