PRMT3 Rabbit Polyclonal Antibody

CAT#: TA329912

Rabbit Polyclonal Anti-PRMT3 Antibody

Product Images

WB Suggested Anti-PRMT3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRMT3 antibody: synthetic peptide directed towards the middle region of human PRMT3. Synthetic peptide located within the following region: FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: protein arginine methyltransferase 3
• Database Link:
  NP_005779
  Entrez Gene 10196 Human
  UniProt ID O60678
• Background: PRMT3 is a ribosomal protein methyltransferase that affects the cellular level of ribosomal subunits
• Synonyms: HRMT1L3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Yeast: 79%

Reference Data

• Protein Families: Druggable Genome