Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-USP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-USP10 antibody: synthetic peptide directed towards the middle region of human USP10. Synthetic peptide located within the following region: GVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSK |
USP10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human USP10 |
USP10 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 499-798 of human USP10 (NP_005144.2). |
| Modifications | Unmodified |
USP10 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human USP10 |
Active filters
Target Symbol
- USP10
Reactivities
- Human
Clonalities
- Polyclonal