Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-XPNPEP3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-XPNPEP3 antibody: synthetic peptide directed towards the N terminal of human XPNPEP3. Synthetic peptide located within the following region: PVPERRIPNRYLGQPSPFTHPHLLRPGEVTPGLSQVEYALRRHKLMSLIQ

Rabbit polyclonal antibody to XPNPEP3 (X-prolyl aminopeptidase (aminopeptidase P) 3, putative)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 12 and 507 of XPNPEP3 (Uniprot ID#Q9NQH7)

Anti-XPNPEP3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-49 amino acids of human X-prolyl aminopeptidase (aminopeptidase P) 3, putative

XPNPEP3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human XPNPEP3

XPNPEP3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human XPNPEP3

XPNPEP3 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human XPNPEP3

XPNPEP3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human XPNPEP3 (NP_071381.1).
Modifications Unmodified