Goat Anti-FACL4 / ACSL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HYLKDIERMYGGK, from the C Terminus of the protein sequence according to NP_004449.1; NP_075266.1. |
Goat Anti-FACL4 / ACSL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-HYLKDIERMYGGK, from the C Terminus of the protein sequence according to NP_004449.1; NP_075266.1. |
Rabbit Polyclonal Anti-Acsl4 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Acsl4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Acsl4. Synthetic peptide located within the following region: KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGG |
Rabbit Polyclonal Anti-ACSL4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACSL4 |
ACSL4 rabbit polyclonal antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACSL4 |
ACSL4 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ACSL4 (NP_004449.1). |
Modifications | Unmodified |