Acsl4 Rabbit Polyclonal Antibody

CAT#: TA338631

Rabbit Polyclonal Anti-Acsl4 Antibody

Product Images

Host: Rabbit; Target Name: Acsl4; Sample Tissue: Mouse Thymus lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Acsl4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Acsl4. Synthetic peptide located within the following region: KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 79 kDa
• Gene Name: acyl-CoA synthetase long-chain family member 4
• Database Link:
  NP_997508
  Entrez Gene 50790 Mouse
  UniProt ID Q9QUJ7
• Background: Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses arachidonate and eicosapentaenoate as substrates.
• Synonyms: ACS4; FACL4; LACS4; MRX63; MRX68
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%