Primary Antibodies

Jump to Filters
View as table Download
glucose 6 phosphatase, catalytic subunit (G6PC) Rabbit Polyclonal Antibody
TA334651

USD 375.00

5 Days

Rabbit Polyclonal Anti-G6pc Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-G6pc antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGI
G6pc Rabbit Polyclonal Antibody
TA376421

USD 220.00

3 Weeks

G6PC Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of Mouse G6PC.
Modifications Unmodified