Goat Polyclonal Antibody against Tafazzin
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HLKTQAEQLHNH, from the C Terminus of the protein sequence according to NP_000107.1; NP_851828.1; NP_851829.1; NP_851830.1. |
Rabbit Polyclonal Anti-TAZ Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAZ antibody is: synthetic peptide directed towards the C-terminal region of TAZ. Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ |
Tafazzin / TAZ Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 174-248 of human Tafazzin / TAZ (NP_851830.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
