TAZ Rabbit Polyclonal Antibody

CAT#: TA343306

Rabbit Polyclonal Anti-TAZ Antibody

Product Images

Lanes: Lane 1: 20ug mouse cardiac mitochondria lysate; Lane 2: 20ug mouse cardiac mitochondria lysate; Lane 3: 20ug mouse cardiac mitochondria lysate; Lane 4: 20ug mouse cardiac mitochondria lysate; Primary Antibody Dilution: ; 1:500; Secondary Antibody:

• 

  WB Suggested Anti-TAZ Antibody; Titration: 1.0 ug/ml; Positive Control: Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TAZ antibody is: synthetic peptide directed towards the C-terminal region of TAZ. Synthetic peptide located within the following region: PNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: tafazzin
• Database Link:
  NP_851828
  Entrez Gene 66826 MouseEntrez Gene 6901 Human
  UniProt ID Q16635
• Background: This gene encodes a protein that is expressed at high levels in cardiac and skeletal muscle. Mutations in this gene have been associated with a number of clinical disorders including Barth syndrome, dilated cardiomyopathy (DCM), hypertrophic DCM, endocardial fibroelastosis, and left ventricular noncompaction (LVNC). Multiple transcript variants encoding different isoforms have been described. A long form and a short form of each of these isoforms is produced; the short form lacks a hydrophobic leader sequence and may exist as a cytoplasmic protein rather than being membrane-bound. Other alternatively spliced transcripts have been described but the full-length nature of all these transcripts is not known.
• Synonyms: BTHS; CMD3A; EFE; EFE2; G4.5; LVNCX; Taz1
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%

Reference Data

• Protein Families: ES Cell Differentiation/IPS, Transmembrane