Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-B3galnt1 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-B3galnt1 Antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FTGYPLIENYSYRGFFHKNHISYQEYPFKVFPPYCSGLGYIMSGDLVPKI

B3GALNT1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 44-331 of human B3GALNT1 (NP_003772.1).
Modifications Unmodified