Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CRABP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRABP2 antibody: synthetic peptide directed towards the middle region of human CRABP2. Synthetic peptide located within the following region: AAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKS

Anti-CRABP2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.87~91(K-W-E-S-E) derived from Human CRABP2

Rabbit Polyclonal Anti-CRABP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRABP2 antibody: synthetic peptide directed towards the middle region of human CRABP2. Synthetic peptide located within the following region: FEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELI

CRABP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 86-116 amino acids from the C-terminal region of Human CRABP2.

Rabbit polyclonal anti-CRABP2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CRABP2.

Rabbit Polyclonal Anti-CRABP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRABP2 antibody is: synthetic peptide directed towards the middle region of Human CRABP2. Synthetic peptide located within the following region: PCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVV

Rabbit Polyclonal Anti-CRABP2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CRABP2

CRABP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CRABP2

CRABP2 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human CRABP2 (NP_001869.1).
Modifications Unmodified