CRABP2 Rabbit Polyclonal Antibody

CAT#: TA330909

Rabbit Polyclonal Anti-CRABP2 Antibody

Product Images

Host: Rabbit; Target Name: CRABP2; Sample Tissue: Hela Whole Cell lysates; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CRABP2 antibody is: synthetic peptide directed towards the middle region of Human CRABP2. Synthetic peptide located within the following region: PCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: cellular retinoic acid binding protein 2
• Database Link:
  NP_001869
  Entrez Gene 1382 Human
  UniProt ID P29373
• Background: A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 gene suggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein.
• Synonyms: CRABP-II; RBP6
• Note: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 91%; Dog: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors