Primary Antibodies

View as table Download

Rabbit polyclonal WAVE1 (Tyr125) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V).
Modifications Phospho-specific

WASF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human WASF1 (NP_001020107.1).
Modifications Unmodified

WASF1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400 to the C-terminus of human WASF1 (NP_001020107.1).
Modifications Unmodified

Rabbit polyclonal WAVE1 (Ab-125) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human WAVE1 around the phosphorylation site of tyrosine 125 (E-T-YP-D-V).

WASF1 Antibody

Applications IHC
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence TPYRDDGKEGLKFYTNPSYFFDLWKEKMLQDTEDKRKEKRKQKQKNLDRP

WASF1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human WASF1

WASF1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human WASF1