Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Human Apo AII |
Apolipoprotein A II (APOA2) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Human Apo AII |
Rabbit Polyclonal Anti-APOA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
Rabbit polyclonal anti-APOA2 antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This APOA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-56 amino acids from the Central region of human APOA2. |
Apolipoprotein A2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Apolipoprotein A2 (NP_001634.1). |
Modifications | Unmodified |