Germany
Japan
United Kingdom
China
Apolipoprotein A II (APOA2) Rabbit Polyclonal Antibody
Other products for "APOA2"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-APOA2 antibody: synthetic peptide directed towards the N terminal of human APOA2. Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 9 kDa |
| Gene Name | apolipoprotein A2 |
| Database Link | |
| Background | This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia. |
| Synonyms | Apo-AII; ApoA-II; apoAII |
| Note | Immunogen Sequence Homology: Dog: 100%; Human: 100%; Rat: 93%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 85%; Rabbit: 79% |
| Reference Data | |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | PPAR signaling pathway |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.