Primary Antibodies

View as table Download

CMKLR1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CMKLR1

Rabbit polyclonal anti-CMKLR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CMKLR1.

Rabbit Polyclonal Anti-CMKLR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CMKLR1 antibody: synthetic peptide directed towards the C terminal of human CMKLR1. Synthetic peptide located within the following region: KKFKVALFSRLVNALSEDTGHSSYPSHRSFTKMSSMNERTSMNERETGML

Rabbit Polyclonal Anti-CMKLR1 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHEMR23 / CMKLR1 antibody was raised against synthetic 19 amino acid peptide from C-terminal cytoplasmic domain of human CMKLR1. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Marmoset, Rabbit (95%); Horse (84%).

Rabbit Polyclonal Anti-CMKLR1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CMKLR1

CMKLR1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CMKLR1

CMKLR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1).
Modifications Unmodified

CMKLR1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CMKLR1 (NP_001135815.1).
Modifications Unmodified

CMKLR1 Rabbit polyclonal Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CMKLR1. AA range:221-270