Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CRY1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CRY1 antibody: synthetic peptide directed towards the N terminal of human CRY1. Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF

Cryptochrome I (CRY1) (551-555) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Mouse
Immunogen Peptide sequence around aa.551~555 (S-Q-G-S-G) derived from Human CRY1.

Cryptochrome I (CRY1) (551-555) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Mouse
Immunogen Peptide sequence around aa.551~555 (S-Q-G-S-G) derived from Human CRY1.

Rabbit polyclonal anti-CRY1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CRY1.

CRY1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse CRY1

CRY1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human CRY1 (NP_004066.1).
Modifications Unmodified

CRY1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 507-586 of human CRY1 (NP_004066.1).
Modifications Unmodified

CRY1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-255 of human CRY1 (NP_004066.1).
Modifications Unmodified