Primary Antibodies

Jump to Filters
View as table Download
DOCK2 Rabbit Polyclonal Antibody
TA340057

USD 375.00

5 Days

Rabbit Polyclonal Anti-DOCK2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DOCK2 antibody: synthetic peptide directed towards the middle region of human DOCK2. Synthetic peptide located within the following region: ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA
DOCK2 Rabbit Polyclonal Antibody
TA375577

USD 220.00

3 Weeks

DOCK2 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1551-1830 of human DOCK2 (NP_004937.1).
Modifications Unmodified