DOCK2 Rabbit Polyclonal Antibody

CAT#: TA340057

Rabbit Polyclonal Anti-DOCK2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "DOCK2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-DOCK2 antibody: synthetic peptide directed towards the middle region of human DOCK2. Synthetic peptide located within the following region: ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 212 kDa
Gene Name dedicator of cytokinesis 2
Background The DOCK2 gene encodes a hematopoietic cell-specific CDM family protein that is indispensable for lymphocyte chemotaxis.
Synonyms FLJ46592; KIAA0209
Note Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Pig: 92%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Bovine: 86%; Dog: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Chemokine signaling pathway, Fc gamma R-mediated phagocytosis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.