Primary Antibodies

View as table Download

GPT2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPT2

Rabbit polyclonal anti-GPT2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPT2 antibody: synthetic peptide directed towards the C terminal of human GPT2. Synthetic peptide located within the following region: PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR

GPT2 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human GPT2