GPT2 Rabbit Polyclonal Antibody

CAT#: TA329574

Rabbit polyclonal anti-GPT2 antibody

Product Images

WB Suggested Anti-GPT2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPT2 antibody: synthetic peptide directed towards the C terminal of human GPT2. Synthetic peptide located within the following region: PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: glutamic pyruvate transaminase (alanine aminotransferase) 2
• Database Link:
  NP_597700
  Entrez Gene 84706 Human
  UniProt ID Q8TD30
• Background: GPT and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.
• Synonyms: ALT2
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Pathways: Alanine, aspartate and glutamate metabolism, Metabolic pathways