Goat Anti-IDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1. |
Goat Anti-IDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KHFRFRDLEEDP, from the internal region of the protein sequence according to NP_000193.1. |
Rabbit Polyclonal Anti-IDS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IDS antibody: synthetic peptide directed towards the N terminal of human IDS. Synthetic peptide located within the following region: SFPPYHPSSEKYENTKTCRGPDGELHANLLCPVDVLDVPEGTLPDKQSTE |
IDS Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse IDS |
IDS rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IDS |
IDS rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IDS |
IDS Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 34-290 of human IDS (NP_006114.1). |
Modifications | Unmodified |