IL16 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL16 |
IL16 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human IL16 |
Rabbit anti-IL16 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human IL16 |
Rabbit Polyclonal IL-16 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IL-16 antibody was raised against a 20 amino acid peptide near the amino terminus of human IL-16. |
Rabbit Polyclonal IL-16 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | IL-16 antibody was raised against a 14 amino acid peptide near the amino terminus of human IL-16. |
Rabbit Polyclonal IL16 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal antibody to IL16 (interleukin 16 (lymphocyte chemoattractant factor))
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1268 and 1332 of IL16 (Uniprot ID#Q14005) |
Anti-Human IL-16 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-16 (129 a.a.) |
IL16 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Biotinylated Anti-Human IL-16 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-16 (129 a.a.) |
Rabbit Polyclonal Anti-IL16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL16 antibody is: synthetic peptide directed towards the C-terminal region of Human IL16. Synthetic peptide located within the following region: EILQLGGTAMQGLTRFEAWNIIKALPDGPVTIVIRRKSLQSKETTAAGDS |