KCNA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA3 |
KCNA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA3 |
Rabbit Polyclonal Anti-KV1.3 (extracellular)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide KDYPASTSQDSFEA(C), corresponding to amino acid residues 263-276 of human Kv1.3.Extracellular loop between domains S1 and S2. |
KCNA3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
KCNA3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 238-268 amino acids from the Central region of human KCNA3 |
Rabbit Polyclonal Anti-KV1.3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GST fusion protein with sequence TLSKSEYMVIEEGGMNHSAFPQTPFKTGNSTATCTTNNNPNSCVNIKKIFTDV, corresponding to amino acid residues 523-575 of human Kv1.3. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-KCNA3 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | KCNA3 / Kv1.3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNA3 / Kv1.3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Mouse, Rat (88%). |
Rabbit Polyclonal Anti-KCNA3 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | KCNA3 / Kv1.3 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human KCNA3 / Kv1.3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Rabbit, Pig (100%); Bovine, Opossum (94%); Lizard (88%); Turkey, Chicken (81%). |
KCNA3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNA3 |