KCNMB3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNMB3 |
KCNMB3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNMB3 |
KCNMB3 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Gorilla |
Immunogen | KCNMB3 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (87%); Marmoset (80%). |
KCNMB3 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Immunogen | KCNMB3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Bovine, Bat, Horse (88%); Gibbon, Dog, Pig (82%). |
Rabbit polyclonal Anti-sloBeta3 (KCNMB3) (extracellular)
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)HYDEEAIRTNPK, corresponding to amino acid residues 134- 145 of rat SloÃ?3. Extracellular loop. |
Rabbit Polyclonal Anti-KCNMB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC |
Rabbit Polyclonal Anti-KCNMB3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNMB3 |