Rabbit Polyclonal Anti-SUZ12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the C terminal of human SUZ12. Synthetic peptide located within the following region: ESASPANEEITEEQNGTANGFSEINSKEKALETDSVSGVSKQSKKQKL |
Rabbit Polyclonal Anti-SUZ12 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the middle region of human SUZ12. Synthetic peptide located within the following region: TGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQ |
Rabbit Polyclonal SUZ12 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Anti-SUZ12 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide (KLH-coupled) derived from human SUZ12 |
SUZ12 Rabbit polyclonal Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 470-739 of human SUZ12 (NP_056170.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
