Rabbit Polyclonal NTH1 Antibody
Applications | WB |
Reactivities | Bovine, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human NTH1 conjugated to KLH. |
Rabbit Polyclonal NTH1 Antibody
Applications | WB |
Reactivities | Bovine, Human, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the human NTH1 conjugated to KLH. |
Rabbit Polyclonal NTH1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Full-length recombinant protein. |
Rabbit Polyclonal Anti-NTHL1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS |
Rabbit Polyclonal anti-NTHL1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NTHL1 |
Rabbit Polyclonal anti-NTHL1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NTHL1 |