NTH1 (NTHL1) Rabbit Polyclonal Antibody

CAT#: TA338254

Rabbit Polyclonal Anti-NTHL1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "NTHL1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name nth-like DNA glycosylase 1
Background The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity.
Synonyms hNTH1; NTH1; OCTS3
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Mouse: 93%; Pig: 87%; Dog: 79%; Rat: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways Base excision repair

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.