Goat Polyclonal Antibody against SMUG1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQAFLLGSIHEPA-C, from the N Terminus of the protein sequence according to NP_055126. |
Goat Polyclonal Antibody against SMUG1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PQAFLLGSIHEPA-C, from the N Terminus of the protein sequence according to NP_055126. |
Rabbit polyclonal anti-SMUG1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SMUG1. |
Rabbit Polyclonal Anti-SMUG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMUG1 antibody: synthetic peptide directed towards the middle region of human SMUG1. Synthetic peptide located within the following region: IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC |
Carrier-free (BSA/glycerol-free) SMUG1 mouse monoclonal antibody,clone OTI5G1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMUG1 mouse monoclonal antibody,clone OTI6B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMUG1 mouse monoclonal antibody,clone OTI5G1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMUG1 mouse monoclonal antibody,clone OTI5G1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMUG1 mouse monoclonal antibody,clone OTI6B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
SMUG1 mouse monoclonal antibody,clone OTI6B3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-SMUG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMUG1 |
Rabbit polyclonal anti-SMUG1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMUG1 |