Rabbit Polyclonal Anti-TRPM4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide EKEQSWIPKIFKK(C), corresponding to amino acid residues 5-17 of human TRPM4. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-TRPM4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide EKEQSWIPKIFKK(C), corresponding to amino acid residues 5-17 of human TRPM4. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-TRPM4 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI |
Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI14C3 (formerly 14C3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Anti-TRPM4 mouse monoclonal antibody, clone OTI14C3 (formerly 14C3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TRPM4 mouse monoclonal antibody, clone OTI14C3 (formerly 14C3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TRPM4 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TRPM4 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |